SCOPe 2.06: Domain d3auvf2: 3auv F:136-252

Lineage for d3auvf2 (3auv F:136-252)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d3auvf2: 3auv F:136-252 [208389]
   automated match to d1dzba1

Details for d3auvf2

PDB Entry: 3auv, 2.4 Å

PDB Description: Predicting Amino Acid Preferences in the Complementarity Determining Regions of an Antibody-Antigen Recognition Interface

PDB Compounds: (F:) sc-dsFv derived from the G6-Fab

SCOPe Domain Sequences for d3auvf2:

Sequence; same for both SEQRES and ATOM records:

>d3auvf2 b.1.1.0 (F:136-252) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvesggglvqpggslrlscaasgftisdywihwvrqapgkclewvagitpaggytyya
dsvkgrftisadtskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtv

Timeline for d3auvf2:

• d3auvf2 first appeared in SCOPe 2.03
  
• d3auvf2 appears in SCOPe 2.05
  
• d3auvf2 appears in the current release, SCOPe 2.07