SCOP 1.73: Domain d1ld9e_: 1ld9 E:

Lineage for d1ld9e_ (1ld9 E:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein beta2-microglobulin [88600] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (85 PDB entries)

8. Domain d1ld9e_: 1ld9 E: [20838]
   Other proteins in same PDB: d1ld9a1, d1ld9a2, d1ld9d1, d1ld9d2

Details for d1ld9e_

PDB Entry: 1ld9, 2.4 Å

PDB Description: the three-dimensional structure of an h-2ld peptide complex explains the unique interaction of ld with beta2m and peptide

PDB Compounds: (E:) beta-2 microglobulin

SCOP Domain Sequences for d1ld9e_:

Sequence; same for both SEQRES and ATOM records:

>d1ld9e_ b.1.1.2 (E:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1ld9e_:

• d1ld9e_ first appeared (with stable ids) in SCOP 1.55, called d1ld9e1
  
• d1ld9e_ appears in SCOP 1.71
  
• d1ld9e_ appears in SCOP 1.75
  
• d1ld9e_ appears in the current release, SCOPe 2.08