Lineage for d1ld9e_ (1ld9 E:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 452578Protein beta2-microglobulin [88600] (4 species)
  7. 452709Species Mouse (Mus musculus) [TaxId:10090] [88603] (60 PDB entries)
  8. 452766Domain d1ld9e_: 1ld9 E: [20838]
    Other proteins in same PDB: d1ld9a1, d1ld9a2, d1ld9d1, d1ld9d2

Details for d1ld9e_

PDB Entry: 1ld9 (more details), 2.4 Å

PDB Description: the three-dimensional structure of an h-2ld peptide complex explains the unique interaction of ld with beta2m and peptide

SCOP Domain Sequences for d1ld9e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ld9e_ b.1.1.2 (E:) beta2-microglobulin {Mouse (Mus musculus)}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d1ld9e_:

Click to download the PDB-style file with coordinates for d1ld9e_.
(The format of our PDB-style files is described here.)

Timeline for d1ld9e_: