SCOPe 2.05: Domain d1ld9d1: 1ld9 D:182-268

Lineage for d1ld9d1 (1ld9 D:182-268)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (103 PDB entries)
   Uniprot P01901 22-299

8. Domain d1ld9d1: 1ld9 D:182-268 [20837]
   Other proteins in same PDB: d1ld9a2, d1ld9b_, d1ld9d2, d1ld9e_

Details for d1ld9d1

PDB Entry: 1ld9, 2.4 Å

PDB Description: the three-dimensional structure of an h-2ld peptide complex explains the unique interaction of ld with beta2m and peptide

PDB Compounds: (D:) MHC class I h-2ld heavy chain

SCOPe Domain Sequences for d1ld9d1:

Sequence; same for both SEQRES and ATOM records:

>d1ld9d1 b.1.1.2 (D:182-268) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpe

Timeline for d1ld9d1:

• d1ld9d1 first appeared (with stable ids) in SCOP 1.55
  
• d1ld9d1 appears in SCOPe 2.04
  
• d1ld9d1 appears in SCOPe 2.06
  
• d1ld9d1 appears in the current release, SCOPe 2.08