Lineage for d1ld9d1 (1ld9 D:182-268)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654537Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 654719Species Mouse (Mus musculus) [TaxId:10090] [88606] (78 PDB entries)
  8. 654796Domain d1ld9d1: 1ld9 D:182-268 [20837]
    Other proteins in same PDB: d1ld9a2, d1ld9b_, d1ld9d2, d1ld9e_

Details for d1ld9d1

PDB Entry: 1ld9 (more details), 2.4 Å

PDB Description: the three-dimensional structure of an h-2ld peptide complex explains the unique interaction of ld with beta2m and peptide
PDB Compounds: (D:) MHC class I h-2ld heavy chain

SCOP Domain Sequences for d1ld9d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ld9d1 b.1.1.2 (D:182-268) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpe

SCOP Domain Coordinates for d1ld9d1:

Click to download the PDB-style file with coordinates for d1ld9d1.
(The format of our PDB-style files is described here.)

Timeline for d1ld9d1: