Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Escherichia coli [TaxId:562] [187725] (8 PDB entries) |
Domain d3asve_: 3asv E: [208360] automated match to d2nwqd_ complexed with nap, po4 |
PDB Entry: 3asv (more details), 2.7 Å
SCOPe Domain Sequences for d3asve_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3asve_ c.2.1.0 (E:) automated matches {Escherichia coli [TaxId: 562]} mivlvtgatagfgecitrrfiqqghkviatgrrqerlqelkdelgdnlyiaqldvrnraa ieemlaslpaewcnidilvnnaglalgmepahkasvedwetmidtnnkglvymtravlpg mvernhghiinigstagswpyaggnvygatkafvrqfslnlrtdlhgtavrvtdiepglv ggtefsnvrfkgddgkaektyqntvaltpedvseavwwvstlpahvnintlemmpvtqsy aglnvhrq
Timeline for d3asve_: