SCOPe 2.05: Domain d3arla_: 3arl A:

Lineage for d3arla_ (3arl A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.0: automated matches [191420] (1 protein)
   not a true family

6. Protein automated matches [190590] (18 species)
   not a true protein

7. Species Tokunagayusurika akamusi [TaxId:28383] [188112] (10 PDB entries)

8. Domain d3arla_: 3arl A: [208350]
   automated match to d1x3ka_
   complexed with cl, hem

Details for d3arla_

PDB Entry: 3arl, 1.81 Å

PDB Description: Cl- binding hemoglobin component V form Propsilocerus akamusi under 500 mM NaCl at pH 5.5

PDB Compounds: (A:) hemoglobin v

SCOPe Domain Sequences for d3arla_:

Sequence; same for both SEQRES and ATOM records:

>d3arla_ a.1.1.0 (A:) automated matches {Tokunagayusurika akamusi [TaxId: 28383]}
afvglsdseeklvrdawapihgdlqgtantvfynylkkypsnqdkfetlkghpldevkdt
anfkliagriftifdncvknvgndkgfqkviadmsgphvarpithgsyndlrgviydsmh
ldsthgaawnkmmdnffyvfyecldgrcsqfs

Timeline for d3arla_:

• d3arla_ first appeared in SCOPe 2.03
  
• d3arla_ appears in SCOPe 2.04
  
• d3arla_ appears in SCOPe 2.06
  
• d3arla_ appears in the current release, SCOPe 2.08