Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88606] (66 PDB entries) |
Domain d1ld9a1: 1ld9 A:182-268 [20835] Other proteins in same PDB: d1ld9a2, d1ld9b_, d1ld9d2, d1ld9e_ |
PDB Entry: 1ld9 (more details), 2.4 Å
SCOP Domain Sequences for d1ld9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ld9a1 b.1.1.2 (A:182-268) Class I MHC, alpha-3 domain {Mouse (Mus musculus)} tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf qkwasvvvplgkeqnytcrvyheglpe
Timeline for d1ld9a1:
View in 3D Domains from other chains: (mouse over for more information) d1ld9b_, d1ld9d1, d1ld9d2, d1ld9e_ |