Lineage for d1ld9a1 (1ld9 A:182-268)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 52919Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species)
  7. 53132Species Mouse (Mus musculus), H-2LD [TaxId:10090] [48962] (2 PDB entries)
  8. 53133Domain d1ld9a1: 1ld9 A:182-268 [20835]
    Other proteins in same PDB: d1ld9a2, d1ld9d2

Details for d1ld9a1

PDB Entry: 1ld9 (more details), 2.4 Å

PDB Description: the three-dimensional structure of an h-2ld peptide complex explains the unique interaction of ld with beta2m and peptide

SCOP Domain Sequences for d1ld9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ld9a1 b.1.1.2 (A:182-268) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2LD}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpe

SCOP Domain Coordinates for d1ld9a1:

Click to download the PDB-style file with coordinates for d1ld9a1.
(The format of our PDB-style files is described here.)

Timeline for d1ld9a1: