Lineage for d1mhce_ (1mhc E:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1758823Protein beta2-microglobulin [88600] (5 species)
  7. 1759459Species Mouse (Mus musculus) [TaxId:10090] [88603] (174 PDB entries)
    Uniprot P01887
  8. 1759523Domain d1mhce_: 1mhc E: [20834]
    Other proteins in same PDB: d1mhca1, d1mhca2, d1mhcd1, d1mhcd2
    complexed with nag

Details for d1mhce_

PDB Entry: 1mhc (more details), 2.1 Å

PDB Description: model of mhc class i h2-m3 with nonapeptide from rat nd1 refined at 2.3 angstroms resolution
PDB Compounds: (E:) MHC class I antigen h2-m3

SCOPe Domain Sequences for d1mhce_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhce_ b.1.1.2 (E:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d1mhce_:

Click to download the PDB-style file with coordinates for d1mhce_.
(The format of our PDB-style files is described here.)

Timeline for d1mhce_: