SCOPe 2.08: Domain d1mhce_: 1mhc E:

Lineage for d1mhce_ (1mhc E:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (7 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries)
   Uniprot P01887

8. Domain d1mhce_: 1mhc E: [20834]
   Other proteins in same PDB: d1mhca1, d1mhca2, d1mhcd1, d1mhcd2
   complexed with nag

Details for d1mhce_

PDB Entry: 1mhc, 2.1 Å

PDB Description: model of mhc class i h2-m3 with nonapeptide from rat nd1 refined at 2.3 angstroms resolution

PDB Compounds: (E:) MHC class I antigen h2-m3

SCOPe Domain Sequences for d1mhce_:

Sequence; same for both SEQRES and ATOM records:

>d1mhce_ b.1.1.2 (E:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1mhce_:

• d1mhce_ first appeared (with stable ids) in SCOP 1.55, called d1mhce1
  
• d1mhce_ appears in SCOPe 2.07