Lineage for d1mhca1 (1mhc A:182-276)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654537Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 654719Species Mouse (Mus musculus) [TaxId:10090] [88606] (78 PDB entries)
  8. 654749Domain d1mhca1: 1mhc A:182-276 [20831]
    Other proteins in same PDB: d1mhca2, d1mhcb_, d1mhcd2, d1mhce_

Details for d1mhca1

PDB Entry: 1mhc (more details), 2.1 Å

PDB Description: model of mhc class i h2-m3 with nonapeptide from rat nd1 refined at 2.3 angstroms resolution
PDB Compounds: (A:) MHC class I antigen h2-m3

SCOP Domain Sequences for d1mhca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhca1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
adppkahvahhprpkgdvtlrcwalgfypaditltwqkdeedltqdmelvetrpsgdgtf
qkwaavvvpsgeeqrytcyvhheglteplalkwrs

SCOP Domain Coordinates for d1mhca1:

Click to download the PDB-style file with coordinates for d1mhca1.
(The format of our PDB-style files is described here.)

Timeline for d1mhca1: