Lineage for d1mhca1 (1mhc A:182-276)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 158811Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)
  7. 159073Species Mouse (Mus musculus), H-2M3 [TaxId:10090] [48961] (1 PDB entry)
  8. 159074Domain d1mhca1: 1mhc A:182-276 [20831]
    Other proteins in same PDB: d1mhca2, d1mhcd2

Details for d1mhca1

PDB Entry: 1mhc (more details), 2.1 Å

PDB Description: model of mhc class i h2-m3 with nonapeptide from rat nd1 refined at 2.3 angstroms resolution

SCOP Domain Sequences for d1mhca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhca1 b.1.1.2 (A:182-276) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2M3}
adppkahvahhprpkgdvtlrcwalgfypaditltwqkdeedltqdmelvetrpsgdgtf
qkwaavvvpsgeeqrytcyvhheglteplalkwrs

SCOP Domain Coordinates for d1mhca1:

Click to download the PDB-style file with coordinates for d1mhca1.
(The format of our PDB-style files is described here.)

Timeline for d1mhca1: