SCOPe 2.05: Domain d3aq5a_: 3aq5 A:

Lineage for d3aq5a_ (3aq5 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.0: automated matches [191420] (1 protein)
   not a true family

6. Protein automated matches [190590] (18 species)
   not a true protein

7. Species Tetrahymena pyriformis [TaxId:5908] [226112] (5 PDB entries)

8. Domain d3aq5a_: 3aq5 A: [208302]
   automated match to d1s61b_
   complexed with hem, oxy

Details for d3aq5a_

PDB Entry: 3aq5, 1.78 Å

PDB Description: Crystal structure of truncated hemoglobin from Tetrahymena pyriformis, Fe(II)-O2 form

PDB Compounds: (A:) Group 1 truncated hemoglobin

SCOPe Domain Sequences for d3aq5a_:

Sequence; same for both SEQRES and ATOM records:

>d3aq5a_ a.1.1.0 (A:) automated matches {Tetrahymena pyriformis [TaxId: 5908]}
qtiyeklggenamkaavplfykkvladervkhffkntdmdhqtkqqtdfltmllggpnhy
kgknmteahkgmnlqnlhfdaiienlaatlkelgvtdavineaakviehtrkdmlgk

Timeline for d3aq5a_:

• d3aq5a_ first appeared in SCOPe 2.03
  
• d3aq5a_ appears in SCOPe 2.04
  
• d3aq5a_ appears in SCOPe 2.06
  
• d3aq5a_ appears in the current release, SCOPe 2.08