Lineage for d3aofa_ (3aof A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1339265Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1341162Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 1341163Protein automated matches [190075] (46 species)
    not a true protein
  7. 1341435Species Thermotoga maritima [TaxId:243274] [226181] (7 PDB entries)
  8. 1341436Domain d3aofa_: 3aof A: [208287]
    automated match to d1ceoa_

Details for d3aofa_

PDB Entry: 3aof (more details), 1.29 Å

PDB Description: crystal structures of thermotoga maritima cel5a in complex with mannotriose substrate
PDB Compounds: (A:) endoglucanase

SCOPe Domain Sequences for d3aofa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aofa_ c.1.8.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
dpfernkilgrginignaleapnegdwgvvikdeffdiikeagfshvripirwsthayaf
ppykimdrffkrvdevingalkrglavvinihhyeelmndpeehkerflalwkqiadryk
dypetlffeilnaphgnltpekwnelleealkvirsidkkhtiiigtaewggisalekls
vpkweknsivtihyynpfefthqgaewvegsekwlgrkwgspddqkhlieefnfieewsk
knkrpiyigefgayrkadlesrikwtsfvvremekrrwslaywefcsgfgvydtlrktwn
kdlleali

SCOPe Domain Coordinates for d3aofa_:

Click to download the PDB-style file with coordinates for d3aofa_.
(The format of our PDB-style files is described here.)

Timeline for d3aofa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3aofb_