SCOPe 2.08: Domain d3aofa_: 3aof A:

Lineage for d3aofa_ (3aof A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (132 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [226181] (7 PDB entries)

8. Domain d3aofa_: 3aof A: [208287]
   automated match to d1ceoa_

Details for d3aofa_

PDB Entry: 3aof, 1.29 Å

PDB Description: crystal structures of thermotoga maritima cel5a in complex with mannotriose substrate

PDB Compounds: (A:) endoglucanase

SCOPe Domain Sequences for d3aofa_:

Sequence; same for both SEQRES and ATOM records:

>d3aofa_ c.1.8.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
dpfernkilgrginignaleapnegdwgvvikdeffdiikeagfshvripirwsthayaf
ppykimdrffkrvdevingalkrglavvinihhyeelmndpeehkerflalwkqiadryk
dypetlffeilnaphgnltpekwnelleealkvirsidkkhtiiigtaewggisalekls
vpkweknsivtihyynpfefthqgaewvegsekwlgrkwgspddqkhlieefnfieewsk
knkrpiyigefgayrkadlesrikwtsfvvremekrrwslaywefcsgfgvydtlrktwn
kdlleali

Timeline for d3aofa_:

• d3aofa_ first appeared in SCOPe 2.03
  
• d3aofa_ appears in SCOPe 2.07