Lineage for d3amzb4 (3amz B:415-528)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962835Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2962998Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) (S)
    automatically mapped to Pfam PF03450
  5. 2962999Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (5 proteins)
  6. 2963037Protein Xanthine oxidase, domain 4 (?) [55452] (1 species)
  7. 2963038Species Cow (Bos taurus) [TaxId:9913] [55453] (10 PDB entries)
    Uniprot P80457
  8. 2963044Domain d3amzb4: 3amz B:415-528 [208281]
    Other proteins in same PDB: d3amza1, d3amza2, d3amza3, d3amza5, d3amza6, d3amzb1, d3amzb2, d3amzb3, d3amzb5, d3amzb6
    automated match to d1v97a4
    complexed with bct, ca, fad, fes, gol, mos, mte, nai, urc

Details for d3amzb4

PDB Entry: 3amz (more details), 2.1 Å

PDB Description: Bovine Xanthine Oxidoreductase urate bound form
PDB Compounds: (B:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3amzb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3amzb4 d.87.2.1 (B:415-528) Xanthine oxidase, domain 4 (?) {Cow (Bos taurus) [TaxId: 9913]}
deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql
skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklg

SCOPe Domain Coordinates for d3amzb4:

Click to download the PDB-style file with coordinates for d3amzb4.
(The format of our PDB-style files is described here.)

Timeline for d3amzb4: