SCOP 1.61: Domain d1fg2j1: 1fg2 J:182-274

Lineage for d1fg2j1 (1fg2 J:182-274)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)

7. Species Mouse (Mus musculus), H-2DB [TaxId:10090] [48960] (9 PDB entries)

8. Domain d1fg2j1: 1fg2 J:182-274 [20827]
   Other proteins in same PDB: d1fg2a2, d1fg2d2, d1fg2g2, d1fg2j2

Details for d1fg2j1

PDB Entry: 1fg2, 2.75 Å

PDB Description: crystal structure of the lcmv peptidic epitope gp33 in complex with the murine class i mhc molecule h-2db

SCOP Domain Sequences for d1fg2j1:

Sequence; same for both SEQRES and ATOM records:

>d1fg2j1 b.1.1.2 (J:182-274) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2DB}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrw

Timeline for d1fg2j1:

• d1fg2j1 first appeared (with stable ids) in SCOP 1.55
  
• d1fg2j1 appears in SCOP 1.59
  
• d1fg2j1 appears in SCOP 1.63
  
• d1fg2j1 appears in the current release, SCOPe 2.08