SCOPe 2.03: Domain d3amoa3: 3amo A:212-627

Lineage for d3amoa3 (3amo A:212-627)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.30: Supersandwich [49993] (3 superfamilies)
   sandwich; 18 strands in 2 sheets

4. Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family)
   automatically mapped to Pfam PF01179

5. Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 proteins)

6. Protein Copper amine oxidase, domain 3 [50000] (4 species)

7. Species Arthrobacter globiformis [TaxId:1665] [50003] (40 PDB entries)
   Uniprot P46881 9-628

8. Domain d3amoa3: 3amo A:212-627 [208268]
   Other proteins in same PDB: d3amoa1, d3amoa2, d3amob1, d3amob2
   automated match to d1ivwa1
   complexed with cu, gol, na

Details for d3amoa3

PDB Entry: 3amo, 2.1 Å

PDB Description: time-resolved x-ray crystal structure analysis of enzymatic reaction of copper amine oxidase from arthrobacter globiformis

PDB Compounds: (A:) phenylethylamine oxidase

SCOPe Domain Sequences for d3amoa3:

Sequence; same for both SEQRES and ATOM records:

>d3amoa3 b.30.2.1 (A:212-627) Copper amine oxidase, domain 3 {Arthrobacter globiformis [TaxId: 1665]}
plrttqkpisitqpegpsftvtggnhiewekwsldvgfdvregvvlhniafrdgdrlrpi
inrasiaemvvpygdpspirswqnyfdtgeylvgqyanslelgcdclgditylspvisda
fgnpreirngicmheedwgilakhsdlwsginytrrnrrmvisffttignydygfywyly
ldgtiefeakatgvvftsafpeggsdnisqlapglgapfhqhifsarldmaidgftnrve
eedvvrqtmgpgnergnafsrkrtvltreseavreadartgrtwiisnpesknrlnepvg
yklhahnqptlladpgssiarraafatkdlwvtryadderyptgdfvnqhsggaglpsyi
aqdrdidgqdivvwhtfglthfprvedwpimpvdtvgfklrpegffdrspvldvpa

Timeline for d3amoa3:

• d3amoa3 is new in SCOPe 2.03-stable
  
• d3amoa3 appears in SCOPe 2.04
  
• d3amoa3 appears in the current release, SCOPe 2.08