Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (46 species) not a true protein |
Species Thermotoga maritima [TaxId:243274] [226181] (7 PDB entries) |
Domain d3amdc_: 3amd C: [208262] automated match to d1ceca_ |
PDB Entry: 3amd (more details), 2 Å
SCOPe Domain Sequences for d3amdc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3amdc_ c.1.8.0 (C:) automated matches {Thermotoga maritima [TaxId: 243274]} vdpfernkilgrginignaleapnegdwgvvikdeffdiikeagfshvripirwsthaya fppykimdrffkrvdevingalkrglavvinihhyeelmndpeehkerflalwkqiadry kdypetlffeilnephgnltpekwnelleealkvirsidkkhtiiigtaewggisalekl svpkweknsivtihyynpfefthqgaewvegsekwlgrkwgspddqkhlieefnfieews kknkrpiyigefgayrkadlesrikwtsfvvremekrrwswaywefcsgfgvydtlrktw nkdlleali
Timeline for d3amdc_: