SCOP 1.65: Domain d1fg2h_: 1fg2 H:

Lineage for d1fg2h_ (1fg2 H:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein beta2-microglobulin [88600] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (48 PDB entries)

8. Domain d1fg2h_: 1fg2 H: [20826]
   Other proteins in same PDB: d1fg2a1, d1fg2a2, d1fg2d1, d1fg2d2, d1fg2g1, d1fg2g2, d1fg2j1, d1fg2j2

Details for d1fg2h_

PDB Entry: 1fg2, 2.75 Å

PDB Description: crystal structure of the lcmv peptidic epitope gp33 in complex with the murine class i mhc molecule h-2db

SCOP Domain Sequences for d1fg2h_:

Sequence; same for both SEQRES and ATOM records:

>d1fg2h_ b.1.1.2 (H:) beta2-microglobulin {Mouse (Mus musculus)}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1fg2h_:

• d1fg2h_ first appeared (with stable ids) in SCOP 1.55, called d1fg2h1
  
• d1fg2h_ appears in SCOP 1.63
  
• d1fg2h_ appears in SCOP 1.67
  
• d1fg2h_ appears in the current release, SCOPe 2.08