Class a: All alpha proteins [46456] (289 folds) |
Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily) core: 4 helices, bundle |
Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) contains 2Fe-2S cluster |
Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins) |
Protein Xanthine oxidase, domain 2 [47746] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [47747] (11 PDB entries) Uniprot P80457 |
Domain d3am9a2: 3am9 A:93-165 [208247] Other proteins in same PDB: d3am9a1, d3am9a3, d3am9a4, d3am9a5, d3am9a6, d3am9b1, d3am9b3, d3am9b4, d3am9b5, d3am9b6 automated match to d1fo4a1 complexed with bct, ca, fad, fes, fyo, gol, mos, mte |
PDB Entry: 3am9 (more details), 2.17 Å
SCOPe Domain Sequences for d3am9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3am9a2 a.56.1.1 (A:93-165) Xanthine oxidase, domain 2 {Cow (Bos taurus) [TaxId: 9913]} stktrlhpvqeriakshgsqcgfctpgivmsmytllrnqpeptveeiedafqgnlcrctg yrpilqgfrtfak
Timeline for d3am9a2: