Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species) |
Species Mouse (Mus musculus), H-2DB [TaxId:10090] [48960] (7 PDB entries) |
Domain d1fg2e1: 1fg2 E: [20824] Other proteins in same PDB: d1fg2a2, d1fg2d2, d1fg2g2, d1fg2j2 |
PDB Entry: 1fg2 (more details), 2.75 Å
SCOP Domain Sequences for d1fg2e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fg2e1 b.1.1.2 (E:) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2DB} iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Timeline for d1fg2e1: