SCOPe 2.03: Domain d1fg2b_: 1fg2 B:

Lineage for d1fg2b_ (1fg2 B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (155 PDB entries)
   Uniprot P01887

8. Domain d1fg2b_: 1fg2 B: [20822]
   Other proteins in same PDB: d1fg2a1, d1fg2a2, d1fg2d1, d1fg2d2, d1fg2g1, d1fg2g2, d1fg2j1, d1fg2j2

Details for d1fg2b_

PDB Entry: 1fg2, 2.75 Å

PDB Description: crystal structure of the lcmv peptidic epitope gp33 in complex with the murine class i mhc molecule h-2db

PDB Compounds: (B:) beta-2 microglobulin

SCOPe Domain Sequences for d1fg2b_:

Sequence; same for both SEQRES and ATOM records:

>d1fg2b_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1fg2b_:

• d1fg2b_ first appeared (with stable ids) in SCOP 1.55, called d1fg2b1
  
• d1fg2b_ appears in SCOPe 2.02
  
• d1fg2b_ appears in SCOPe 2.04
  
• d1fg2b_ appears in the current release, SCOPe 2.08