Lineage for d1fg2b_ (1fg2 B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 548300Protein beta2-microglobulin [88600] (4 species)
  7. 548438Species Mouse (Mus musculus) [TaxId:10090] [88603] (66 PDB entries)
  8. 548510Domain d1fg2b_: 1fg2 B: [20822]
    Other proteins in same PDB: d1fg2a1, d1fg2a2, d1fg2d1, d1fg2d2, d1fg2g1, d1fg2g2, d1fg2j1, d1fg2j2

Details for d1fg2b_

PDB Entry: 1fg2 (more details), 2.75 Å

PDB Description: crystal structure of the lcmv peptidic epitope gp33 in complex with the murine class i mhc molecule h-2db

SCOP Domain Sequences for d1fg2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fg2b_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus)}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d1fg2b_:

Click to download the PDB-style file with coordinates for d1fg2b_.
(The format of our PDB-style files is described here.)

Timeline for d1fg2b_: