Lineage for d3ahvb_ (3ahv B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1339265Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1341162Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 1341163Protein automated matches [190075] (46 species)
    not a true protein
  7. 1341260Species Oryza sativa [TaxId:39947] [225407] (23 PDB entries)
  8. 1341287Domain d3ahvb_: 3ahv B: [208216]
    automated match to d1v03a_
    complexed with g2f, gol, mes, so4, zn; mutant

Details for d3ahvb_

PDB Entry: 3ahv (more details), 1.89 Å

PDB Description: semi-active e176q mutant of rice bglu1 covalent complex with 2-deoxy- 2-fluoroglucoside
PDB Compounds: (B:) Beta-glucosidase 7

SCOPe Domain Sequences for d3ahvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ahvb_ c.1.8.0 (B:) automated matches {Oryza sativa [TaxId: 39947]}
nwlgglsraafpkrfvfgtvtsayqvegmaasggrgpsiwdafahtpgnvagnqngdvat
dqyhrykedvnlmkslnfdayrfsiswsrifpdgegrvnqegvayynnlinyllqkgitp
yvnlyhydlplalekkyggwlnakmadlfteyadfcfktfgnrvkhwftfnqprivallg
ydqgtnppkrctkcaaggnsatepyivahnfllshaaavaryrtkyqaaqqgkvgivldf
nwyealsnstedqaaaqrardfhigwyldplinghypqimqdlvkdrlpkftpeqarlvk
gsadyiginqytasymkgqqlmqqtptsysadwqvtyvfakngkpigpqansnwlyivpw
gmygcvnyikqkygnptvvitengmdqpanlsrdqylrdttrvhfyrsyltqlkkaideg
anvagyfawslldnfewlsgytskfgivyvdfntlerhpkasaywfrdmlkh

SCOPe Domain Coordinates for d3ahvb_:

Click to download the PDB-style file with coordinates for d3ahvb_.
(The format of our PDB-style files is described here.)

Timeline for d3ahvb_: