Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88606] (66 PDB entries) |
Domain d1fg2a1: 1fg2 A:182-274 [20821] Other proteins in same PDB: d1fg2a2, d1fg2b_, d1fg2d2, d1fg2e_, d1fg2g2, d1fg2h_, d1fg2j2, d1fg2k_ |
PDB Entry: 1fg2 (more details), 2.75 Å
SCOP Domain Sequences for d1fg2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fg2a1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus)} tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf qkwasvvvplgkeqnytcrvyheglpepltlrw
Timeline for d1fg2a1: