Lineage for d1fg2a1 (1fg2 A:182-274)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103286Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)
  7. 103449Species Mouse (Mus musculus), H-2DB [TaxId:10090] [48960] (7 PDB entries)
  8. 103460Domain d1fg2a1: 1fg2 A:182-274 [20821]
    Other proteins in same PDB: d1fg2a2, d1fg2d2, d1fg2g2, d1fg2j2

Details for d1fg2a1

PDB Entry: 1fg2 (more details), 2.75 Å

PDB Description: crystal structure of the lcmv peptidic epitope gp33 in complex with the murine class i mhc molecule h-2db

SCOP Domain Sequences for d1fg2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fg2a1 b.1.1.2 (A:182-274) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2DB}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrw

SCOP Domain Coordinates for d1fg2a1:

Click to download the PDB-style file with coordinates for d1fg2a1.
(The format of our PDB-style files is described here.)

Timeline for d1fg2a1: