![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
![]() | Protein automated matches [190770] (47 species) not a true protein |
![]() | Species Clostridium josui [TaxId:1499] [225844] (4 PDB entries) |
![]() | Domain d3acfa_: 3acf A: [208196] automated match to d1uwwa_ complexed with ca, so4 |
PDB Entry: 3acf (more details), 1.6 Å
SCOPe Domain Sequences for d3acfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3acfa_ b.18.1.0 (A:) automated matches {Clostridium josui [TaxId: 1499]} ravveapvehapigkatlpstfedstrqgwawdatsgvqsaltikdaneskaiswevkyp evkpvdgwasaprimlgnvnttrgnnkyltfdfylkptqaskgsltislafappslgfwa qatgdvniplsslskmkkttdglyhfqvkydldkindgkvltantvlrditivvadgnsd fagtmyldnirfe
Timeline for d3acfa_: