SCOPe 2.05: Domain d3aajb_: 3aaj B:

Lineage for d3aajb_ (3aaj B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (27 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189519] (38 PDB entries)

8. Domain d3aajb_: 3aaj B: [208185]
   automated match to d1juoa_
   complexed with ca

Details for d3aajb_

PDB Entry: 3aaj, 2.4 Å

PDB Description: Crystal structure of Ca2+-bound form of des3-23ALG-2deltaGF122

PDB Compounds: (B:) programmed cell death protein 6

SCOPe Domain Sequences for d3aajb_:

Sequence; same for both SEQRES and ATOM records:

>d3aajb_ a.39.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lwnvfqrvdkdrsgvisdtelqqalsngtwtpfnpvtvrsiismfdrenkagvnfseftg
vwkyitdwqnvfrtydrdnsgmidknelkqalsgyrlsdqfhdilirkfdrqgrgqiafd
dfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvfsiv

Timeline for d3aajb_:

• d3aajb_ first appeared in SCOPe 2.03
  
• d3aajb_ appears in SCOPe 2.04
  
• d3aajb_ appears in SCOPe 2.06
  
• d3aajb_ appears in the current release, SCOPe 2.08