Lineage for d1hocb_ (1hoc B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 364355Protein beta2-microglobulin [88600] (4 species)
  7. 364479Species Mouse (Mus musculus) [TaxId:10090] [88603] (59 PDB entries)
  8. 364526Domain d1hocb_: 1hoc B: [20816]
    Other proteins in same PDB: d1hoca1, d1hoca2

Details for d1hocb_

PDB Entry: 1hoc (more details), 2.4 Å

PDB Description: the three-dimensional structure of h-2db at 2.4 angstroms resolution: implications for antigen-determinant selection

SCOP Domain Sequences for d1hocb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hocb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus)}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d1hocb_:

Click to download the PDB-style file with coordinates for d1hocb_.
(The format of our PDB-style files is described here.)

Timeline for d1hocb_: