Lineage for d3a9ma_ (3a9m A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1979527Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 1979528Protein automated matches [190590] (21 species)
    not a true protein
  7. 1979686Species Tokunagayusurika akamusi [TaxId:28383] [188112] (10 PDB entries)
  8. 1979696Domain d3a9ma_: 3a9m A: [208159]
    automated match to d1x3ka_
    complexed with cmo, hem

Details for d3a9ma_

PDB Entry: 3a9m (more details), 1.8 Å

PDB Description: Crystal structure of a hemoglobin component V from Propsilocerus akamusi (pH9.0 coordinates)
PDB Compounds: (A:) hemoglobin v

SCOPe Domain Sequences for d3a9ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a9ma_ a.1.1.0 (A:) automated matches {Tokunagayusurika akamusi [TaxId: 28383]}
afvglsdseeklvrdawapihgdlqgtantvfynylkkypsnqdkfetlkghpldevkdt
anfkliagriftifdncvknvgndkgfqkviadmsgphvarpithgsyndlrgviydsmh
ldsthgaawnkmmdnffyvfyecldgrcsqfs

SCOPe Domain Coordinates for d3a9ma_:

Click to download the PDB-style file with coordinates for d3a9ma_.
(The format of our PDB-style files is described here.)

Timeline for d3a9ma_: