SCOPe 2.03: Domain d1hoca1: 1hoc A:182-272

Lineage for d1hoca1 (1hoc A:182-272)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (101 PDB entries)
   Uniprot P01901 22-299

8. Domain d1hoca1: 1hoc A:182-272 [20815]
   Other proteins in same PDB: d1hoca2, d1hocb_

Details for d1hoca1

PDB Entry: 1hoc, 2.4 Å

PDB Description: the three-dimensional structure of h-2db at 2.4 angstroms resolution: implications for antigen-determinant selection

PDB Compounds: (A:) class I histocompatibility antigen (h2-db) (alpha chain)

SCOPe Domain Sequences for d1hoca1:

Sequence; same for both SEQRES and ATOM records:

>d1hoca1 b.1.1.2 (A:182-272) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltl

Timeline for d1hoca1:

• d1hoca1 first appeared (with stable ids) in SCOP 1.55
  
• d1hoca1 appears in SCOPe 2.02
  
• d1hoca1 appears in SCOPe 2.04
  
• d1hoca1 appears in the current release, SCOPe 2.08