![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein beta2-microglobulin [88600] (4 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88603] (66 PDB entries) |
![]() | Domain d1g6rl_: 1g6r L: [20812] Other proteins in same PDB: d1g6ra1, d1g6ra2, d1g6rb1, d1g6rb2, d1g6rc1, d1g6rc2, d1g6rd1, d1g6rd2, d1g6rh1, d1g6rh2, d1g6ri1, d1g6ri2 |
PDB Entry: 1g6r (more details), 2.8 Å
SCOP Domain Sequences for d1g6rl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g6rl_ b.1.1.2 (L:) beta2-microglobulin {Mouse (Mus musculus)} iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Timeline for d1g6rl_: