Lineage for d1g6rl_ (1g6r L:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2745638Protein beta2-microglobulin [88600] (7 species)
  7. 2746421Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries)
    Uniprot P01887
  8. 2746738Domain d1g6rl_: 1g6r L: [20812]
    Other proteins in same PDB: d1g6ra1, d1g6ra2, d1g6rb1, d1g6rb2, d1g6rc1, d1g6rc2, d1g6rd1, d1g6rd2, d1g6rh1, d1g6rh2, d1g6ri1, d1g6ri2

Details for d1g6rl_

PDB Entry: 1g6r (more details), 2.8 Å

PDB Description: a functional hot spot for antigen recognition in a superagonist tcr/mhc complex
PDB Compounds: (L:) beta-2 microglobulin

SCOPe Domain Sequences for d1g6rl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g6rl_ b.1.1.2 (L:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d1g6rl_:

Click to download the PDB-style file with coordinates for d1g6rl_.
(The format of our PDB-style files is described here.)

Timeline for d1g6rl_: