Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (64 species) not a true protein |
Species Methanocaldococcus jannaschii [TaxId:2190] [225914] (2 PDB entries) |
Domain d3a4tb_: 3a4t B: [208106] automated match to d2b9ea1 complexed with sfg |
PDB Entry: 3a4t (more details), 2.3 Å
SCOPe Domain Sequences for d3a4tb_:
Sequence, based on SEQRES records: (download)
>d3a4tb_ c.66.1.0 (B:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]} mqfirvntlkinpevlkkrlenkgvvlektfldyafevkkspfsigstpeylfgyympqs issmippivlnpreddfildmcaapggktthlaqlmknkgtivaveisktrtkalksnin rmgvlntiiinadmrkykdyllkneiffdkilldapcsgniikdknrnvseedikycslr qkelidigidllkkdgelvystcsmeveeneevikyilqkrndveliiikanefkginik egyikgtlrvfppnepffiaklrki
>d3a4tb_ c.66.1.0 (B:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]} mqfirvntlkinpevlkkrlenkgvvlektfldyafevkkspfsigstpeylfgyympqs issmippivlnpreddfildmcaapggktthlaqlmknkgtivaveisktrtkalksnin rmgvlntiiinadmrkykdyllkneiffdkilldapcsgndikycslrqkelidigidll kkdgelvystcsmeveeneevikyilqkrndveliiikanefkginikegyikgtlrvfp pnepffiaklrki
Timeline for d3a4tb_: