Lineage for d3a2fb2 (3a2f B:118-248)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1927131Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 1927132Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 1927317Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 1927465Protein automated matches [227006] (4 species)
    not a true protein
  7. 1927497Species Pyrococcus furiosus [TaxId:2261] [225778] (1 PDB entry)
  8. 1927499Domain d3a2fb2: 3a2f B:118-248 [208099]
    Other proteins in same PDB: d3a2fa1, d3a2fa2
    automated match to d1ge8a2
    protein/DNA complex; mutant

Details for d3a2fb2

PDB Entry: 3a2f (more details), 2.67 Å

PDB Description: crystal structure of pyrococcus furiosus dna polymerase/pcna monomer mutant complex
PDB Compounds: (B:) DNA polymerase sliding clamp

SCOPe Domain Sequences for d3a2fb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a2fb2 d.131.1.2 (B:118-248) automated matches {Pyrococcus furiosus [TaxId: 2261]}
veemevdlpelpftakvvvlgevlkaavkaaslvsdsikfiarenefimkaegetqevei
kltledeglldievqeetksaygvsylsdmvkglgkadevtikfgnempmqmeyyirdeg
rltfllaprve

SCOPe Domain Coordinates for d3a2fb2:

Click to download the PDB-style file with coordinates for d3a2fb2.
(The format of our PDB-style files is described here.)

Timeline for d3a2fb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3a2fb1