![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
![]() | Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
![]() | Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) ![]() "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
![]() | Family e.8.1.0: automated matches [227142] (1 protein) not a true family |
![]() | Protein automated matches [226844] (4 species) not a true protein |
![]() | Species Pyrococcus furiosus [TaxId:2261] [224944] (3 PDB entries) |
![]() | Domain d3a2fa2: 3a2f A:348-773 [208097] Other proteins in same PDB: d3a2fa1, d3a2fb1, d3a2fb2 automated match to d2vwja2 protein/DNA complex; mutant |
PDB Entry: 3a2f (more details), 2.67 Å
SCOPe Domain Sequences for d3a2fa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a2fa2 e.8.1.0 (A:348-773) automated matches {Pyrococcus furiosus [TaxId: 2261]} stgnlvewfllrkayernevapnkpseeeyqrrlresytggfvkepekglwenivyldfr alypsiiithnvspdtlnlegcknydiapqvghkfckdipgfipsllghlleerqkiktk mketqdpiekilldyrqkaikllansfygyygyakarwyckecaesvtawgrkyielvwk eleekfgfkvlyidtdglyatipggeseeikkkalefvkyinsklpglleleyegfykrg ffvtkkryavideegkvitrgleivrrdwseiaketqarvletilkhgdveeavrivkev iqklanyeippeklaiyeqitrplheykaigphvavakklaakgvkikpgmvigyivlrg dgpisnrailaeeydpkkhkydaeyyienqvlpavlrilegfgyrkedlryqktrqvglt swlnik
Timeline for d3a2fa2: