Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.47: Met-10+ protein-like [142622] (1 protein) Pfam PF02475; contains extra N-terminal alpha+beta domain: beta(2)-alpha-beta(2); mixed beta-sheet; order: 1234; cf (102740) |
Protein Hypothetical protein PH0793 [142623] (2 species) |
Species Pyrococcus horikoshii [TaxId:53953] [142624] (3 PDB entries) Uniprot O58523 19-278 |
Domain d3a25a_: 3a25 A: [208081] automated match to d3k6ra_ complexed with sam |
PDB Entry: 3a25 (more details), 2.3 Å
SCOPe Domain Sequences for d3a25a_:
Sequence, based on SEQRES records: (download)
>d3a25a_ c.66.1.47 (A:) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} ikprireilskelpeelvkllpkrwvrigdvlllplrpelepykhriaevyaevlgvktv lrkghihgetrkpdyellygsdtvtvhvengikykldvakimfspanvkervrmakvakp delvvdmfagighlslpiavygkakviaiekdpytfkflvenihlnkvedrmsaynmdnr dfpgeniadrilmgyvvrthefipkalsiakdgaiihyhntvpeklmprepfetfkritk eygydveklnelkikryapgvwhvvldlrvfks
>d3a25a_ c.66.1.47 (A:) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} ikprireilskelpeelvkllpkrwvrigdvlllplrpelepykhriaevyaevlgvktv lrkgdyellygsdtvtvhvengikykldvakimfspanvkervrmakvakpdelvvdmfa gighlslpiavygkakviaiekdpytfkflvenihlnkvedrmsaynmdnrdfpgeniad rilmgyvvrthefipkalsiakdgaiihyhntvpeklmprepfetfkritkeygydvekl nelkikryapgvwhvvldlrvfks
Timeline for d3a25a_: