SCOP 1.73: Domain d2ckbl_: 2ckb L:

Lineage for d2ckbl_ (2ckb L:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein beta2-microglobulin [88600] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (85 PDB entries)

8. Domain d2ckbl_: 2ckb L: [20808]
   Other proteins in same PDB: d2ckba1, d2ckba2, d2ckbb1, d2ckbb2, d2ckbc1, d2ckbc2, d2ckbd1, d2ckbd2, d2ckbh1, d2ckbh2, d2ckbi1, d2ckbi2

Details for d2ckbl_

PDB Entry: 2ckb, 3.2 Å

PDB Description: structure of the 2c/kb/dev8 complex

PDB Compounds: (L:) beta-2 microglobulin

SCOP Domain Sequences for d2ckbl_:

Sequence; same for both SEQRES and ATOM records:

>d2ckbl_ b.1.1.2 (L:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d2ckbl_:

• d2ckbl_ first appeared (with stable ids) in SCOP 1.55, called d2ckbl1
  
• d2ckbl_ appears in SCOP 1.71
  
• d2ckbl_ appears in SCOP 1.75
  
• d2ckbl_ appears in the current release, SCOPe 2.08