SCOPe 2.08: Domain d3a13i2: 3a13 I:136-444

Lineage for d3a13i2 (3a13 I:136-444)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families)
   automatically mapped to Pfam PF00016

5. Family c.1.14.0: automated matches [227297] (1 protein)
   not a true family

6. Protein automated matches [227123] (9 species)
   not a true protein

7. Species Pyrococcus kodakaraensis [TaxId:69014] [226763] (2 PDB entries)

8. Domain d3a13i2: 3a13 I:136-444 [208078]
   Other proteins in same PDB: d3a13a1, d3a13b1, d3a13c1, d3a13d1, d3a13e1, d3a13f1, d3a13g1, d3a13h1, d3a13i1, d3a13j1
   automated match to d1bxna1
   complexed with ca, cap, mg; mutant

Details for d3a13i2

PDB Entry: 3a13, 2.34 Å

PDB Description: crystal structure of type iii rubisco sp4 mutant complexed with 2-cabp and activated with ca

PDB Compounds: (I:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d3a13i2:

Sequence; same for both SEQRES and ATOM records:

>d3a13i2 c.1.14.0 (I:136-444) automated matches {Pyrococcus kodakaraensis [TaxId: 69014]}
fdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngadymkddenlt
spwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladlglkhamvd
vvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrligidqlhv
gtagagklegerditiqnarilreshykpdendvfhleqkfysikaafptssgglhpgni
qpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakthkelaral
ekwghvtpv

Timeline for d3a13i2:

• d3a13i2 first appeared in SCOPe 2.03
  
• d3a13i2 appears in SCOPe 2.07