SCOPe 2.06: Domain d3a13a1: 3a13 A:9-135

Lineage for d3a13a1 (3a13 A:9-135)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.0: automated matches [227234] (1 protein)
   not a true family

6. Protein automated matches [226983] (18 species)
   not a true protein

7. Species Pyrococcus kodakaraensis [TaxId:69014] [225861] (2 PDB entries)

8. Domain d3a13a1: 3a13 A:9-135 [208061]
   Other proteins in same PDB: d3a13a2, d3a13b2, d3a13c2, d3a13d2, d3a13e2, d3a13f2, d3a13g2, d3a13h2, d3a13i2, d3a13j2
   automated match to d1bxna2
   complexed with ca, cap, mg; mutant

Details for d3a13a1

PDB Entry: 3a13, 2.34 Å

PDB Description: crystal structure of type iii rubisco sp4 mutant complexed with 2-cabp and activated with ca

PDB Compounds: (A:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d3a13a1:

Sequence; same for both SEQRES and ATOM records:

>d3a13a1 d.58.9.0 (A:9-135) automated matches {Pyrococcus kodakaraensis [TaxId: 69014]}
ydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerwa
dlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledlyf
peklire

Timeline for d3a13a1:

• d3a13a1 first appeared in SCOPe 2.03
  
• d3a13a1 appears in SCOPe 2.05
  
• d3a13a1 appears in SCOPe 2.07
  
• d3a13a1 appears in the current release, SCOPe 2.08