Lineage for d3a12i1 (3a12 I:9-136)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1909192Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 1909193Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 1909194Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)
  7. 1909358Species Thermococcus kodakaraensis [TaxId:311400] [69731] (2 PDB entries)
  8. 1909367Domain d3a12i1: 3a12 I:9-136 [208057]
    Other proteins in same PDB: d3a12a2, d3a12b2, d3a12c2, d3a12d2, d3a12e2, d3a12f2, d3a12g2, d3a12h2, d3a12i2, d3a12j2
    automated match to d1geha2
    complexed with cap, mg

Details for d3a12i1

PDB Entry: 3a12 (more details), 2.3 Å

PDB Description: Crystal structure of Type III Rubisco complexed with 2-CABP
PDB Compounds: (I:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d3a12i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a12i1 d.58.9.1 (I:9-136) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Thermococcus kodakaraensis [TaxId: 311400]}
ydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerwa
dlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledlyf
pekliref

SCOPe Domain Coordinates for d3a12i1:

Click to download the PDB-style file with coordinates for d3a12i1.
(The format of our PDB-style files is described here.)

Timeline for d3a12i1: