SCOPe 2.06: Domain d2mhac1: 2mha C:182-270

Lineage for d2mhac1 (2mha C:182-270)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (109 PDB entries)
   Uniprot P01901 22-299

8. Domain d2mhac1: 2mha C:182-270 [20805]
   Other proteins in same PDB: d2mhaa2, d2mhab_, d2mhac2, d2mhad_

Details for d2mhac1

PDB Entry: 2mha, 2.5 Å

PDB Description: crystal structure of the major histocompatibility complex class i h- 2kb molecule containing a single viral peptide: implications for peptide binding and t-cell receptor recognition

PDB Compounds: (C:) class I histocompatibility antigen (h-2kb) (alpha chain)

SCOPe Domain Sequences for d2mhac1:

Sequence; same for both SEQRES and ATOM records:

>d2mhac1 b.1.1.2 (C:182-270) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepl

Timeline for d2mhac1:

• d2mhac1 first appeared (with stable ids) in SCOP 1.55
  
• d2mhac1 appears in SCOPe 2.05
  
• d2mhac1 appears in SCOPe 2.07
  
• d2mhac1 appears in the current release, SCOPe 2.08