| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Class I MHC, alpha-3 domain [88604] (4 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88606] (89 PDB entries) Uniprot P01901 22-299 |
| Domain d2mhac1: 2mha C:182-270 [20805] Other proteins in same PDB: d2mhaa2, d2mhab_, d2mhac2, d2mhad_ |
PDB Entry: 2mha (more details), 2.5 Å
SCOPe Domain Sequences for d2mhac1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mhac1 b.1.1.2 (C:182-270) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepl
Timeline for d2mhac1:
View in 3DDomains from other chains: (mouse over for more information) d2mhaa1, d2mhaa2, d2mhab_, d2mhad_ |