![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Class I MHC, alpha-3 domain [88604] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88606] (60 PDB entries) |
![]() | Domain d2mhac1: 2mha C:182-270 [20805] Other proteins in same PDB: d2mhaa2, d2mhab_, d2mhac2, d2mhad_ |
PDB Entry: 2mha (more details), 2.8 Å
SCOP Domain Sequences for d2mhac1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mhac1 b.1.1.2 (C:182-270) Class I MHC, alpha-3 domain {Mouse (Mus musculus)} tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf qkwasvvvplgkeqyytchvyhqglpepl
Timeline for d2mhac1:
![]() Domains from other chains: (mouse over for more information) d2mhaa1, d2mhaa2, d2mhab_, d2mhad_ |