Lineage for d2mhab1 (2mha B:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103286Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)
  7. 103477Species Mouse (Mus musculus), H-2KB [TaxId:10090] [48959] (15 PDB entries)
  8. 103505Domain d2mhab1: 2mha B: [20804]
    Other proteins in same PDB: d2mhaa2, d2mhac2

Details for d2mhab1

PDB Entry: 2mha (more details), 2.8 Å

PDB Description: crystal structure of the major histocompatibility complex class i h- 2kb molecule containing a single viral peptide: implications for peptide binding and t-cell receptor recognition

SCOP Domain Sequences for d2mhab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mhab1 b.1.1.2 (B:) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2KB}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d2mhab1:

Click to download the PDB-style file with coordinates for d2mhab1.
(The format of our PDB-style files is described here.)

Timeline for d2mhab1: