Lineage for d2mhaa1 (2mha A:182-270)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654537Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 654719Species Mouse (Mus musculus) [TaxId:10090] [88606] (78 PDB entries)
  8. 654834Domain d2mhaa1: 2mha A:182-270 [20803]
    Other proteins in same PDB: d2mhaa2, d2mhab_, d2mhac2, d2mhad_

Details for d2mhaa1

PDB Entry: 2mha (more details), 2.8 Å

PDB Description: crystal structure of the major histocompatibility complex class i h- 2kb molecule containing a single viral peptide: implications for peptide binding and t-cell receptor recognition
PDB Compounds: (A:) class I histocompatibility antigen (h-2kb) (alpha chain)

SCOP Domain Sequences for d2mhaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mhaa1 b.1.1.2 (A:182-270) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepl

SCOP Domain Coordinates for d2mhaa1:

Click to download the PDB-style file with coordinates for d2mhaa1.
(The format of our PDB-style files is described here.)

Timeline for d2mhaa1: