Lineage for d2zydb2 (2zyd B:177-467)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006475Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2006476Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2006685Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2006686Protein automated matches [226851] (35 species)
    not a true protein
  7. 2006728Species Escherichia coli K-12 [TaxId:83333] [225711] (3 PDB entries)
  8. 2006732Domain d2zydb2: 2zyd B:177-467 [208011]
    Other proteins in same PDB: d2zyda1, d2zydb1
    automated match to d1pgja1
    complexed with glo

Details for d2zydb2

PDB Entry: 2zyd (more details), 1.5 Å

PDB Description: dimeric 6-phosphogluconate dehydrogenase complexed with glucose
PDB Compounds: (B:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d2zydb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zydb2 a.100.1.0 (B:177-467) automated matches {Escherichia coli K-12 [TaxId: 83333]}
gaghyvkmvhngieygdmqliaeaysllkgglnltneelaqtftewnngelssyliditk
diftkkdedgnylvdvildeaankgtgkwtsqsaldlgeplslitesvfaryisslkdqr
vaaskvlsgpqaqpagdkaefiekvrralylgkivsyaqgfsqlraaseeynwdlnygei
akifragciiraqflqkitdacaenpqianlllapyfkqiaddyqqalrdvvayavqngi
pvptfsaavayydsyraavlpanliqaqrdyfgahtykridkegvfhtewl

SCOPe Domain Coordinates for d2zydb2:

Click to download the PDB-style file with coordinates for d2zydb2.
(The format of our PDB-style files is described here.)

Timeline for d2zydb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zydb1