SCOPe 2.05: Domain d2zydb2: 2zyd B:177-467

Lineage for d2zydb2 (2zyd B:177-467)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (30 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [225711] (3 PDB entries)

8. Domain d2zydb2: 2zyd B:177-467 [208011]
   Other proteins in same PDB: d2zyda1, d2zydb1
   automated match to d1pgja1
   complexed with glo

Details for d2zydb2

PDB Entry: 2zyd, 1.5 Å

PDB Description: dimeric 6-phosphogluconate dehydrogenase complexed with glucose

PDB Compounds: (B:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d2zydb2:

Sequence; same for both SEQRES and ATOM records:

>d2zydb2 a.100.1.0 (B:177-467) automated matches {Escherichia coli K-12 [TaxId: 83333]}
gaghyvkmvhngieygdmqliaeaysllkgglnltneelaqtftewnngelssyliditk
diftkkdedgnylvdvildeaankgtgkwtsqsaldlgeplslitesvfaryisslkdqr
vaaskvlsgpqaqpagdkaefiekvrralylgkivsyaqgfsqlraaseeynwdlnygei
akifragciiraqflqkitdacaenpqianlllapyfkqiaddyqqalrdvvayavqngi
pvptfsaavayydsyraavlpanliqaqrdyfgahtykridkegvfhtewl

Timeline for d2zydb2:

• d2zydb2 first appeared in SCOPe 2.03
  
• d2zydb2 appears in SCOPe 2.04
  
• d2zydb2 appears in SCOPe 2.06
  
• d2zydb2 appears in the current release, SCOPe 2.08